PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B04996.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family EIL
Protein Properties Length: 606aa    MW: 65112.2 Da    PI: 6.2092
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B04996.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34587.3e-140634581354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel++rmw+d+ +l+rlke+++q+ ++  +     + ++s+e+arrkkmsraQD iLkYMlk+mevcnaqGfvYgiipe+gkpv+gasd+LraWW
  Pahal.B04996.1  63 EELERRMWRDRLRLRRLKEQQQQQGGRGGK-EAPPRPRQSQEHARRKKMSRAQDVILKYMLKMMEVCNAQGFVYGIIPENGKPVTGASDNLRAWW 156
                     8**********************8765555.667789********************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.......XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT-- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgessl...qtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgls 187
                     kekv+fdrngpaa++ yqa+n++++g+       +++ + +hsl+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G e ww+e+g++
  Pahal.B04996.1 157 KEKVRFDRNGPAAVARYQADNAAPGGGGAGgaaVAAAPAGPHSLHELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPQGAEPWWPEAGVP 251
                     ************************9887663223468899******************************************************* PP

                     TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX..XXXX..XXXXXX CS
            EIN3 188 kdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss..slrk..qspkvt 275
                      + g+ppykkphdlkkawkv+vLtavikhmsp+++++r+l+rqsk+lqdkm+a+e  ++l+vl+qee+++   ++    ++  +      + ++ 
  Pahal.B04996.1 252 GELGPPPYKKPHDLKKAWKVAVLTAVIKHMSPDVDKVRRLVRQSKCLQDKMTAREIVTWLAVLKQEEDLYLMQHPGalpPPssN--AaaAAAALP 344
                     **********************************************************************87777776422332..223444444 PP

                     X.XXXXXXXXXXXXXXX.XXXXXXXXXX.................................XXXXXXXXXXXXX.XXXXXXXX.......XXXXX CS
            EIN3 276 l.sceqkedvegkkeskikhvqavktta.................................gfpvvrkrkkkps.esakvssk.evsrtcqssqf 334
                     +  ++ ++dveg ++ + ++ ++ k ++                                 +++  +kr ++ + e++ + s+    +tc ++q+
  Pahal.B04996.1 345 FsASSGEYDVEGADDGE-ETGRNPKPASndapafvdlsssmdatgnsrflmpaalmkeetaDAEYLHKRSAPAGvEPELMLSNsFRAYTCGNAQC 438
                     41456699999555544.3333333333457889***************************999999**987752566665552568******** PP

                     XX.XXXXXXXXXXXXXXXXX CS
            EIN3 335 rgsetelifadknsisqney 354
                     ++s++ ++f d+ +++ ++y
  Pahal.B04996.1 439 PHSSSVHGFLDRGARNAHQY 458
                     ******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.5E-12563318No hitNo description
Gene3DG3DSA:1.10.3180.108.1E-69196325IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.2E-57198321IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MMGGGALVLD QRMPADDKAL FGFGPGECFL GEGDLVNPAP ARDDTMSFPD GDESDDDDVG  60
GIEELERRMW RDRLRLRRLK EQQQQQGGRG GKEAPPRPRQ SQEHARRKKM SRAQDVILKY  120
MLKMMEVCNA QGFVYGIIPE NGKPVTGASD NLRAWWKEKV RFDRNGPAAV ARYQADNAAP  180
GGGGAGGAAV AAAPAGPHSL HELQDTTLGS LLSALMQHCD PPQRRFPLEK GVPPPWWPQG  240
AEPWWPEAGV PGELGPPPYK KPHDLKKAWK VAVLTAVIKH MSPDVDKVRR LVRQSKCLQD  300
KMTAREIVTW LAVLKQEEDL YLMQHPGALP PPSSNAAAAA AALPFSASSG EYDVEGADDG  360
EETGRNPKPA SNDAPAFVDL SSSMDATGNS RFLMPAALMK EETADAEYLH KRSAPAGVEP  420
ELMLSNSFRA YTCGNAQCPH SSSVHGFLDR GARNAHQYTC KFNTPADNSK LAPSVFPPPG  480
QAVGFDLPVD GQRSLAELMD MYEANVGAPR SLSGIDTAAP GGVRVSGPFL TPWLFGGATT  540
GVMQQQQSAG FYVRDDALPF GGDIAAASPE LRFSSGLNVP GSTAHYGGAS QLQQPHKPAG  600
SNWFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B2e-671953201126Protein ETHYLENE INSENSITIVE 3
4zds_A2e-671953201126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958734.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ9SLH01e-157EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLK3ZRI30.0K3ZRI3_SETIT; Uncharacterized protein
STRINGSi029213m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-132ETHYLENE-INSENSITIVE3-like 1